Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50131224 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1526828 |
---|
Ki | 0.010000±n/a nM |
---|
Citation | Hu, H; Wang, X; Chan, GK; Chang, JH; Do, S; Drummond, J; Ebens, A; Lee, W; Ly, J; Lyssikatos, JP; Murray, J; Moffat, JG; Chao, Q; Tsui, V; Wallweber, H; Kolesnikov, A Discovery of 3,5-substituted 6-azaindazoles as potent pan-Pim inhibitors. Bioorg Med Chem Lett25:5258-64 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50131224 |
---|
n/a |
---|
Name | BDBM50131224 |
Synonyms: | CHEMBL3634783 | US9260425, 505 |
Type | Small organic molecule |
Emp. Form. | C20H20N8 |
Mol. Mass. | 372.4264 |
SMILES | Cc1cncc(n1)-c1cc2c(n[nH]c2cn1)-c1cccc(n1)N1CCNCC1 |
Structure |
|