Reaction Details |
| Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50152697 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1565204 (CHEMBL3782598) |
---|
EC50 | 49±n/a nM |
---|
Citation | Li, Z; Qiu, Q; Xu, X; Wang, X; Jiao, L; Su, X; Pan, M; Huang, W; Qian, H Design, synthesis and Structure-activity relationship studies of new thiazole-based free fatty acid receptor 1 agonists for the treatment of type 2 diabetes. Eur J Med Chem113:246-57 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1 | FFAR1_HUMAN | G-protein Coupled Receptor 40 | GPR40 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 31473.32 |
Organism: | Homo sapiens (Human) |
Description: | O14842 |
Residue: | 300 |
Sequence: | MDLPPQLSFGLYVAAFALGFPLNVLAIRGATAHARLRLTPSLVYALNLGCSDLLLTVSLP
LKAVEALASGAWPLPASLCPVFAVAHFFPLYAGGGFLAALSAGRYLGAAFPLGYQAFRRP
CYSWGVCAAIWALVLCHLGLVFGLEAPGGWLDHSNTSLGINTPVNGSPVCLEAWDPASAG
PARFSLSLLLFFLPLAITAFCYVGCLRALARSGLTHRRKLRAAWVAGGALLTLLLCVGPY
NASNVASFLYPNLGGSWRKLGLITGAWSVVLNPLVTGYLGRGPGLKTVCAARTQGGKSQK
|
|
|
BDBM50152697 |
---|
n/a |
---|
Name | BDBM50152697 |
Synonyms: | CHEMBL3781477 |
Type | Small organic molecule |
Emp. Form. | C21H18FNO4S |
Mol. Mass. | 399.435 |
SMILES | Cc1nc(sc1COc1ccc2C(CC(O)=O)COc2c1)-c1ccc(F)cc1 |
Structure |
|