Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50160995 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1570460 (CHEMBL3794687) |
---|
Ki | <1±n/a nM |
---|
Citation | Nishiguchi, GA; Burger, MT; Han, W; Lan, J; Atallah, G; Tamez, V; Lindvall, M; Bellamacina, C; Garcia, P; Feucht, P; Zavorotinskaya, T; Dai, Y; Wong, K Design, synthesis and structure activity relationship of potent pan-PIM kinase inhibitors derived from the pyridyl carboxamide scaffold. Bioorg Med Chem Lett26:2328-32 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50160995 |
---|
n/a |
---|
Name | BDBM50160995 |
Synonyms: | CHEMBL3793938 |
Type | Small organic molecule |
Emp. Form. | C22H17F2N7O |
Mol. Mass. | 433.4135 |
SMILES | Cc1nc(N)cc(n1)-c1ccncc1NC(=O)c1nc(ccc1N)-c1c(F)cccc1F |
Structure |
|