Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Heme oxygenase 1 |
---|
Ligand | BDBM84822 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Heme Oxygenase |
---|
pH | 7.4±0 |
---|
Temperature | 298.15±0 K |
---|
IC50 | 3.2e+4± 2e+3 nM |
---|
Citation | Roman, G; Rahman, MN; Vukomanovic, D; Jia, Z; Nakatsu, K; Szarek, WA Heme oxygenase inhibition by 2-oxy-substituted 1-azolyl-4-phenylbutanes: effect of variation of the azole moiety. X-ray crystal structure of human heme oxygenase-1 in complex with 4-phenyl-1-(1H-1,2,4-triazol-1-yl)-2-butanone. Chem Biol Drug Des75:68-90 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Heme oxygenase 1 |
---|
Name: | Heme oxygenase 1 |
Synonyms: | HMOX1_RAT | HSP32 | Heme Oxygenase 1 (HO-1) | Heme oxygenase 1 | Hmox1 |
Type: | Enzyme |
Mol. Mass.: | 33005.15 |
Organism: | Rattus norvegicus (rat) |
Description: | HO-1 obtained from rat spleen was used in enzyme assays. |
Residue: | 289 |
Sequence: | MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHE
VGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRP
ASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
|
|
|
BDBM84822 |
---|
n/a |
---|
Name | BDBM84822 |
Synonyms: | 1-azolyl-4-phenyl-2-butanone, 24 |
Type | n/a |
Emp. Form. | C19H18N2O |
Mol. Mass. | 290.359 |
SMILES | O=C(CCc1ccccc1)Cn1cnc(c1)-c1ccccc1 |
Structure |
|