Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine 1D receptor |
---|
Ligand | BDBM22869 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1600±n/a nM |
---|
Comments | PDSP_552 |
---|
Citation | Schoemaker, H; Claustre, Y; Fage, D; Rouquier, L; Chergui, K; Curet, O; Oblin, A; Gonon, F; Carter, C; Benavides, J; Scatton, B Neurochemical characteristics of amisulpride, an atypical dopamine D2/D3 receptor antagonist with both presynaptic and limbic selectivity. J Pharmacol Exp Ther280:83-97 (1997) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine 1D receptor |
---|
Name: | 5-hydroxytryptamine 1D receptor |
Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
Type: | Protein |
Mol. Mass.: | 12731.52 |
Organism: | Bos taurus (Bovine) |
Description: | Q8MI13 |
Residue: | 119 |
Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
BDBM22869 |
---|
n/a |
---|
Name | BDBM22869 |
Synonyms: | 6-chloro-10-(4-methylpiperazin-1-yl)-2,9-diazatricyclo[9.4.0.0^{3,8}]pentadeca-1,3(8),4,6,10,12,14-heptaene | CLOZARIL | Clozapine | Leponex | US10259786, Clozapine |
Type | Small organic molecule |
Emp. Form. | C18H19ClN4 |
Mol. Mass. | 326.823 |
SMILES | CN1CCN(CC1)C1=c2ccccc2=Nc2ccc(Cl)cc2N1 |c:8,15| |
Structure |
|