Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM21398 |
---|
Substrate/Competitor | n/a |
---|
Ki | 24±n/a nM |
---|
Comments | PDSP_918 |
---|
Citation | Schoemaker, H; Claustre, Y; Fage, D; Rouquier, L; Chergui, K; Curet, O; Oblin, A; Gonon, F; Carter, C; Benavides, J; Scatton, B Neurochemical characteristics of amisulpride, an atypical dopamine D2/D3 receptor antagonist with both presynaptic and limbic selectivity. J Pharmacol Exp Ther280:83-97 (1997) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor, sigma 1 | Oprs1 | SGMR1_MOUSE | Sigma 1-type opioid receptor | Sigma1-receptor | Sigma1R | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25246.51 |
Organism: | Mus musculus (Mouse) |
Description: | O55242 |
Residue: | 223 |
Sequence: | MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
|
|
|
BDBM21398 |
---|
n/a |
---|
Name | BDBM21398 |
Synonyms: | 4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl) | 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL54 | CHEMBL545608 | Haloperidol | Haloperidol, 1 |
Type | Small organic molecule |
Emp. Form. | C21H23ClFNO2 |
Mol. Mass. | 375.864 |
SMILES | OC1(CCN(CCCC(=O)c2ccc(F)cc2)CC1)c1ccc(Cl)cc1 |
Structure |
|