| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cysteinyl leukotriene receptor 1 |
|---|
| Ligand | BDBM50001285 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 10.4±n/a nM |
|---|
| Comments | PDSP_1241 |
|---|
| Citation |  Nothacker, HP; Wang, Z; Zhu, Y; Reinscheid, RK; Lin, SH; Civelli, O Molecular cloning and characterization of a second human cysteinyl leukotriene receptor: discovery of a subtype selective agonist. Mol Pharmacol58:1601-8 (2000) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Cysteinyl leukotriene receptor 1 |
|---|
| Name: | Cysteinyl leukotriene receptor 1 |
|---|
| Synonyms: | CLTR1_HUMAN | CYSLT1 | CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | Cysteinyl leukotriene receptor 1 | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38565.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271 |
|---|
| Residue: | 337 |
|---|
| Sequence: | MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
|
|
|
|---|
| BDBM50001285 |
|---|
| n/a |
|---|
| Name | BDBM50001285 |
|---|
| Synonyms: | (E)-3-((3-(2-(7-chloroquinolin-2-yl)vinyl)phenyl)(3-(dimethylamino)-3-oxopropylthio)methylthio)propanoic acid | 3-(((3-(2-(7-chloroquinoline-2-yl)ethenyl)phenyl)((3-dimethylamino-3-oxopropyl)thio)methyl)thio)propanoic acid | 3-((3-(2-(7-chloroquinolin-2-yl)vinyl)phenyl)(3-(dimethylamino)-3-oxopropylthio)methylthio)propanoic acid | 3-[{3-[(E)-2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-diethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid | 3-[{3-[(E)-2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid | 3-[{3-[2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid(MK-571) | 3-[{3-[2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionic acid(MK-571, L-660711) | CHEMBL15177 | L-660711 | MK 571 | MK-571 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H27ClN2O3S2 |
|---|
| Mol. Mass. | 515.087 |
|---|
| SMILES | CN(C)C(=O)CCSC(SCCC(O)=O)c1cccc(\C=C\c2ccc3ccc(Cl)cc3n2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
