Reaction Details |
| Report a problem with these data |
Target | Ret proto-oncogene |
---|
Ligand | BDBM50237710 |
---|
Substrate/Competitor | n/a |
---|
Ki | 8678±n/a nM |
---|
Comments | PDSP_6404 |
---|
Citation | Melnick, JS; Janes, J; Kim, S; Chang, JY; Sipes, DG; Gunderson, D; Jarnes, L; Matzen, JT; Garcia, ME; Hood, TL; Beigi, R; Xia, G; Harig, RA; Asatryan, H; Yan, SF; Zhou, Y; Gu, XJ; Saadat, A; Zhou, V; King, FJ; Shaw, CM; Su, AI; Downs, R; Gray, NS; Schultz, PG; Warmuth, M; Caldwell, JS An efficient rapid system for profiling the cellular activities of molecular libraries. Proc Natl Acad Sci U S A103:3153-8 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Ret proto-oncogene |
---|
Name: | Ret proto-oncogene |
Synonyms: | RET proto-oncogene tyrosine kinase receptor |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 3923.37 |
Organism: | Homo sapiens (Human) |
Description: | Ret proto-oncogene 0 HUMAN::Q9UE13 |
Residue: | 35 |
Sequence: | NASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQD
|
|
|
BDBM50237710 |
---|
n/a |
---|
Name | BDBM50237710 |
Synonyms: | 4-methyl-N-[3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl]-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]benzamide | AMN 107 | AMN107 | CHEMBL255863 | NILOTINIB | US11649218, Example Nilotinib |
Type | Small organic molecule |
Emp. Form. | C28H22F3N7O |
Mol. Mass. | 529.5158 |
SMILES | Cc1cn(cn1)-c1cc(NC(=O)c2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)cc(c1)C(F)(F)F |
Structure |
|