| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ret proto-oncogene |
|---|
| Ligand | BDBM50237710 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 8678±n/a nM |
|---|
| Comments | PDSP_6404 |
|---|
| Citation |  Melnick, JS; Janes, J; Kim, S; Chang, JY; Sipes, DG; Gunderson, D; Jarnes, L; Matzen, JT; Garcia, ME; Hood, TL; Beigi, R; Xia, G; Harig, RA; Asatryan, H; Yan, SF; Zhou, Y; Gu, XJ; Saadat, A; Zhou, V; King, FJ; Shaw, CM; Su, AI; Downs, R; Gray, NS; Schultz, PG; Warmuth, M; Caldwell, JS An efficient rapid system for profiling the cellular activities of molecular libraries. Proc Natl Acad Sci U S A103:3153-8 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Ret proto-oncogene |
|---|
| Name: | Ret proto-oncogene |
|---|
| Synonyms: | RET proto-oncogene tyrosine kinase receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 3923.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Ret proto-oncogene 0 HUMAN::Q9UE13 |
|---|
| Residue: | 35 |
|---|
| Sequence: | NASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQD
|
|
|
|---|
| BDBM50237710 |
|---|
| n/a |
|---|
| Name | BDBM50237710 |
|---|
| Synonyms: | 4-methyl-N-[3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl]-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]benzamide | AMN 107 | AMN107 | CHEMBL255863 | NILOTINIB | US11649218, Example Nilotinib |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H22F3N7O |
|---|
| Mol. Mass. | 529.5158 |
|---|
| SMILES | Cc1cn(cn1)-c1cc(NC(=O)c2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)cc(c1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
