| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein UL24 homolog |
|---|
| Ligand | BDBM130376 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Nuclear Magnetic Resonance (NMR) Assay |
|---|
| pH | 8±n/a |
|---|
| IC50 | 1.0e+3± 1e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Gable, JE; Lee, GM; Jaishankar, P; Hearn, BR; Waddling, CA; Renslo, AR; Craik, CS Broad-spectrum allosteric inhibition of herpesvirus proteases. Biochemistry53:4648-60 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein UL24 homolog |
|---|
| Name: | Protein UL24 homolog |
|---|
| Synonyms: | Kaposi's sarcoma-associated herpesvirus protease (KSHV Pr) | ORF20 | UL24_HHV8P |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28447.41 |
|---|
| Organism: | Human herpesvirus 8 |
|---|
| Description: | Q2HRB2 |
|---|
| Residue: | 257 |
|---|
| Sequence: | MVRPTEAEVKKSLSRLPAARKRAGNRAHLATYRRLLKYSTLPDLWRFLSSRPQNPPLGHH
RLFFEVTLGHRIADCVILVSGGHQPVCYVVELKTCLSHQLIPTNTVRTSQRAQGLCQLSD
SIHYIAHSAPPGTEAWTITPLLIFKNQKTLKTVYSESPGAFPTPVHTTEGKLCAFLTARE
NADIRKVLSKVPKKPKMDRGGKILGPTPGKRAVYSQAHHGRNKKGRPWTAQPTRAKSRTK
DKGTPAFPRAGPACSGP
|
|
|
|---|
| BDBM130376 |
|---|
| n/a |
|---|
| Name | BDBM130376 |
|---|
| Synonyms: | N-[2-Benzyl-4-(1H-1,2,3,4-tetrazol-5-yl)phenyl]-6-(cyclohexylmethyl)pyridine-2- carboxamide (2) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H28N6O |
|---|
| Mol. Mass. | 452.5508 |
|---|
| SMILES | O=C(Nc1ccc(cc1Cc1ccccc1)-c1nnn[nH]1)c1cccc(CC2CCCCC2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
