Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase A |
---|
Ligand | BDBM285714 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Protease-Free PPIase Assay |
---|
pH | 7.8±n/a |
---|
Ki | 3.20±n/a nM |
---|
Comments | extracted |
---|
Citation | Pettit, SN; Jones, AD; Frydrych, CS; Thomas, AJ; Garst, ME Cyclosporins modified on the MeBmt sidechain by heterocyclic rings US Patent US10077289 Publication Date 9/18/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase A |
Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
Type: | Protein |
Mol. Mass.: | 18015.32 |
Organism: | Homo sapiens (Human) |
Description: | P62937 |
Residue: | 165 |
Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
BDBM285714 |
---|
n/a |
---|
Name | BDBM285714 |
Synonyms: | US10077289, Compound 22 | [(2S,3R,4R)-3-Hydroxy-4-methyl-2-(methylamino)-7-(pyrimidin-2-yl)-heptanoic acid]1 [(R)-methyl-Sar]3 cyclosporin A |
Type | Small organic molecule |
Emp. Form. | C66H115N13O12 |
Mol. Mass. | 1282.6992 |
SMILES | CC[C@H]1NC(=O)[C@@H]([C@H](O)[C@H](C)CCCc2ncccn2)N(C)C(=O)[C@@H](C(C)C)N(C)C(=O)[C@@H](CC(C)C)N(C)C(=O)[C@@H](CC(C)C)N(C)C(=O)[C@H](C)NC(=O)[C@@H](C)NC(=O)[C@@H](CC(C)C)N(C)C(=O)[C@H](NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)N(C)C1=O)C(C)C |r| |
Structure |
|