Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Decaprenyl diphosphate synthase |
---|
Ligand | BDBM153349 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | DPPS Inhibition (trans FPP based) Assay |
---|
pH | 7.5±n/a |
---|
IC50 | 5.4e+3±n/a nM |
---|
Comments | extracted |
---|
Citation | Kim, MO; Feng, X; Feixas, F; Zhu, W; Lindert, S; Bogue, S; Sinko, W; de Oliveira, C; Rao, G; Oldfield, E; McCammon, JA A Molecular Dynamics Investigation of Mycobacterium tuberculosis Prenyl Synthases: Conformational Flexibility and Implications for Computer-aided Drug Discovery. Chem Biol Drug Des85:756-69 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Decaprenyl diphosphate synthase |
---|
Name: | Decaprenyl diphosphate synthase |
Synonyms: | DPDS_MYCTO | cis-Decaprenyl diphosphate synthase (cis-DPPS) | uppS |
Type: | Protein |
Mol. Mass.: | 33800.02 |
Organism: | Mycobacterium tuberculosis H37Rv |
Description: | n/a |
Residue: | 296 |
Sequence: | MARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAP
RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAF
STENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEM
TKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD
LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
|
|
|
BDBM153349 |
---|
n/a |
---|
Name | BDBM153349 |
Synonyms: | BPH-624 |
Type | Small organic molecule |
Emp. Form. | C20H20O7P2 |
Mol. Mass. | 434.3161 |
SMILES | OC(Cc1ccc(cc1)-c1ccccc1-c1ccccc1)(P(O)(O)=O)P(O)(O)=O |
Structure |
|