| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tuberculosinyl adenosine transferase |
|---|
| Ligand | BDBM153318 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Rv3378c Inhibition Assay |
|---|
| IC50 | 6.6e+2±n/a nM |
|---|
| Citation |  Kim, MO; Feng, X; Feixas, F; Zhu, W; Lindert, S; Bogue, S; Sinko, W; de Oliveira, C; Rao, G; Oldfield, E; McCammon, JA A Molecular Dynamics Investigation of Mycobacterium tuberculosis Prenyl Synthases: Conformational Flexibility and Implications for Computer-aided Drug Discovery. Chem Biol Drug Des85:756-69 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tuberculosinyl adenosine transferase |
|---|
| Name: | Tuberculosinyl adenosine transferase |
|---|
| Synonyms: | Diterpene synthase | TUBAT_MYCTO | Tuberculosinyl adenosine synthase (Rv3378c) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 34026.59 |
|---|
| Organism: | Mycobacterium tuberculosis H37Rv |
|---|
| Description: | n/a |
|---|
| Residue: | 296 |
|---|
| Sequence: | MNLVSEKEFLDLPLVSVAEIVRCRGPKVSVFPFDGTRRWFHLECNPQYDDYQQAALRQSI
RILKMLFEHGIETVISPIFSDDLLDRGDRYIVQALEGMALLANDEEILSFYKEHEVHVLF
YGDYKKRLPSTAQGAAVVKSFDDLTISTSSNTEHRLCFGVFGNDAAESVAQFSISWNETH
GKPPTRREIIEGYYGEYVDKADMFIGFGRFSTFDFPLLSSGKTSLYFTVAPSYYMTETTL
RRILYDHIYLRHFRPKPDYSAMSADQLNVLRNRYRAQPDRVFGVGCVHDGIWFAEG
|
|
|
|---|
| BDBM153318 |
|---|
| n/a |
|---|
| Name | BDBM153318 |
|---|
| Synonyms: | BPH-1417 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H22N6 |
|---|
| Mol. Mass. | 394.4717 |
|---|
| SMILES | C1CN=C(N1)c1ccc2cc(\C=C\c3cc4ccc(cc4[nH]3)C3=NCCN3)[nH]c2c1 |c:2,t:25| |
|---|
| Structure | 
|
|---|
Search and Browse
