| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM165023 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| Ki | 9.3±n/a nM |
|---|
| Citation |  Chai, W; Deckhut, C; Dvorak, CA; Eccles, W; Edwards, JP; Goldberg, SD; Krawczuk, PJ; Lebsack, AD; Liu, J; Tanis, VM; Tarantino, KT 1,2,5-substituted benzimidazoles as FLAP modulators US Patent US9067917 Publication Date 6/30/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM165023 |
|---|
| n/a |
|---|
| Name | BDBM165023 |
|---|
| Synonyms: | US9067917, 58 | US9682971, 58 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H28FN3O3 |
|---|
| Mol. Mass. | 509.5707 |
|---|
| SMILES | OC(=O)C1(Cc2nc3cc(OCc4ccc5ccccc5n4)ccc3n2Cc2ccc(F)cc2)CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
