| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase Mdm2 [1-118,T47W] |
|---|
| Ligand | BDBM207989 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Microscale Thermophoresis (MT) Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Kd | 7.0e+3± 2e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Surmiak, E; Twarda-Clapa, A; Zak, KM; Musielak, B; Tomala, MD; Kubica, K; Grudnik, P; Madej, M; Jablonski, M; Potempa, J; Kalinowska-Tluscik, J; Dömling, A; Dubin, G; Holak, TA A Unique Mdm2-Binding Mode of the 3-Pyrrolin-2-one- and 2-Furanone-Based Antagonists of the p53-Mdm2 Interaction. ACS Chem Biol11:3310-3318 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase Mdm2 [1-118,T47W] |
|---|
| Name: | E3 ubiquitin-protein ligase Mdm2 [1-118,T47W] |
|---|
| Synonyms: | MDM2 | MDM2_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 13556.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Mdm2 truncation (1-118 aa) with mutation at T47W |
|---|
| Residue: | 118 |
|---|
| Sequence: | MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDWYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDS
|
|
|
|---|
| BDBM207989 |
|---|
| n/a |
|---|
| Name | BDBM207989 |
|---|
| Synonyms: | 5-(4-chlorobenzyl)-3-(6-chloro-1H-indol-3-yl)-4-(4-chlorophenyl)-5-hydroxy-1,5-dihydro-2H-furan-2-one (2f) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H16Cl3NO3 |
|---|
| Mol. Mass. | 484.758 |
|---|
| SMILES | OC1(Cc2ccc(Cl)cc2)OC(=O)C(=C1c1ccc(Cl)cc1)c1c[nH]c2cc(Cl)ccc12 |c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
