| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase type 1 from Tn4003 |
|---|
| Ligand | BDBM210930 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | DHFR Inhibition Assay |
|---|
| IC50 | 2.7e+2± 2e+1 nM |
|---|
| Citation |  Reeve, SM; Scocchera, EW; G-Dayanadan, N; Keshipeddy, S; Krucinska, J; Hajian, B; Ferreira, J; Nailor, M; Aeschlimann, J; Wright, DL; Anderson, AC MRSA Isolates from United States Hospitals Carry dfrG and dfrK Resistance Genes and Succumb to Propargyl-Linked Antifolates. Cell Chem Biol23:1458-1467 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase type 1 from Tn4003 |
|---|
| Name: | Dihydrofolate reductase type 1 from Tn4003 |
|---|
| Synonyms: | DYRA_STAAU | Dihydrofolate reductase (DfrA) | dfrA |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18461.80 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | P13955 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MTLSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFNSIGKPLPNRRN
VVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLYEAMIDQVDDMYITVIDGKFQG
DTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRKGK
|
|
|
|---|
| BDBM210930 |
|---|
| n/a |
|---|
| Name | BDBM210930 |
|---|
| Synonyms: | UCP1173 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H24N4O3 |
|---|
| Mol. Mass. | 416.4724 |
|---|
| SMILES | CCc1nc(N)nc(N)c1C#C[C@H](C)c1cc(OC)cc(c1)-c1ccc(cc1)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
