Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM210932 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | DHFR Inhibition Assay |
---|
IC50 | 41± 6 nM |
---|
Citation | Reeve, SM; Scocchera, EW; G-Dayanadan, N; Keshipeddy, S; Krucinska, J; Hajian, B; Ferreira, J; Nailor, M; Aeschlimann, J; Wright, DL; Anderson, AC MRSA Isolates from United States Hospitals Carry dfrG and dfrK Resistance Genes and Succumb to Propargyl-Linked Antifolates. Cell Chem Biol23:1458-1467 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (DfrK) |
Type: | Protein |
Mol. Mass.: | 19251.04 |
Organism: | Staphylococcus aureus |
Description: | C7C2U7 |
Residue: | 163 |
Sequence: | MKVSLIAAMDKNRVIGKENDIPWRIPEDWEYVKNTTKGYPIILGRKNLESIGRALPGRRN
IILTRDKGFSFNGCEIVHSIEDVFELCNSEEEIFIFGGEQIYNLFLPYVEKMYITKIHYE
FEGDTFFPEVNYEEWNEVSVTQGITNEKNPYTYYFHIYERKAS
|
|
|
BDBM210932 |
---|
n/a |
---|
Name | BDBM210932 |
Synonyms: | UCP1191 |
Type | Small organic molecule |
Emp. Form. | C24H22N4O4 |
Mol. Mass. | 430.4559 |
SMILES | CCc1nc(N)nc(N)c1C#CC(C)c1cc2OCOc2c(c1)-c1ccc(cc1)C(O)=O |
Structure |
|