Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cyclin-dependent kinase 4/G1/S-specific cyclin-D1 |
---|
Ligand | BDBM6709 |
---|
Substrate/Competitor | ING Peptide |
---|
Meas. Tech. | CDK Kinase Inhibition Assay |
---|
pH | 7±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 110±n/a nM |
---|
Citation | Al-awar, RS; Ray, JE; Hecker, KA; Joseph, S; Huang, J; Shih, C; Brooks, HB; Spencer, CD; Watkins, SA; Schultz, RM; Considine, EL; Faul, MM; Sullivan, KA; Kolis, SP; Carr, MA; Zhang, F Preparation of novel aza-1,7-annulated indoles and their conversion to potent indolocarbazole kinase inhibitors. Bioorg Med Chem Lett14:3925-8 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Cyclin-dependent kinase 4/G1/S-specific cyclin-D1 |
---|
Name: | Cyclin-dependent kinase 4/G1/S-specific cyclin-D1 |
Synonyms: | CDK4/CycD | CDK4/CycD1 | CDK4/Cyclin D1 | CDK4/D1 | Cyclin-Dependent Kinase 4 (CDK4) | Cyclin-dependent kinase 4 | Cyclin-dependent kinase 4/G1/S-specific cyclin D1 | Cyclin-dependent kinase 4/cyclin D1 |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | CDK4/D1 complexes were purified from insect cells co-infected with baculovirus vectors containing each of the components. |
Components: | This complex has 2 components. |
Component 1 |
Name: | Cyclin-dependent kinase 4 |
Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
Type: | Enzyme Subunit |
Mol. Mass.: | 33731.96 |
Organism: | Homo sapiens (Human) |
Description: | P11802 |
Residue: | 303 |
Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
Component 2 |
Name: | G1/S-specific cyclin-D1 |
Synonyms: | B-cell lymphoma 1 protein | BCL-1 | BCL-1 oncogene | BCL1 | CCND1 | CCND1_HUMAN | PRAD1 | PRAD1 oncogene |
Type: | Enzyme Subunit |
Mol. Mass.: | 33717.70 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 295 |
Sequence: | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
|
|
|
BDBM6709 |
---|
ING Peptide |
---|
Name: | ING Peptide |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1341.50 |
Organism: | n/a |
Description: | amino acid residues 246-257 from human retinoblastoma 1 protein. |
Residue: | 12 |
Sequence: | |