| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Activin receptor type-1 [172-499,R206H] |
|---|
| Ligand | BDBM451775 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Caliper Assay |
|---|
| IC50 | 8.00±n/a nM |
|---|
| Citation |  Arista, L; Babu, S; Bian, J; Cui, K; Dillon, MP; Lattmann, R; Li, J; Liao, L; Lizos, D; Ramos, R; Stiefl, NJ; Ullrich, T; Usselmann, P; Wang, X; Waykole, LM; Weiler, S; Zhang, Y; Zhou, Y; Zhu, T Aminopyridine derivatives and their use as selective ALK-2 inhibitors US Patent US10710980 Publication Date 7/14/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Activin receptor type-1 [172-499,R206H] |
|---|
| Name: | Activin receptor type-1 [172-499,R206H] |
|---|
| Synonyms: | ACVR1 | ACVR1_HUMAN | ACVRLK2 | Activin receptor type-1 (ALK2 FOP) (R206H aa 172-499) | Activin receptor type-1 (ALK2)(FOP)(R206H) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37120.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 172-499 |
|---|
| Residue: | 328 |
|---|
| Sequence: | TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVAHQITLLECVGKGRYGEVWRGSWQGEN
VAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSL
YDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCC
IADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVL
WEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLA
KLMKECWYQNPSARLTALRIKKTLTKID
|
|
|
|---|
| BDBM451775 |
|---|
| n/a |
|---|
| Name | BDBM451775 |
|---|
| Synonyms: | US10710980, Example 7 | US10947218, Example 7 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36N4O3 |
|---|
| Mol. Mass. | 476.6104 |
|---|
| SMILES | COCCN1C[C@@H]2C[C@@]2(C1)c1ccc(cc1)-c1cnc(N)c(c1)C(=O)NC12CCC(O)(CC1)CC2 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
