| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Isoform A of Ketohexokinase (Peripheral) |
|---|
| Ligand | BDBM319585 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biological Assay |
|---|
| IC50 | 66.0±n/a nM |
|---|
| Citation |  Dowling, M; Fernando, D; Futatsugi, K; Huard, K; Magee, TV; Raymer, B; Shavnya, A; Smith, A; Thuma, B; Tsai, A; Tu, M Substituted 3-azabicyclo[3.1.0]hexanes as ketohexokinase inhibitors US Patent US10787438 Publication Date 9/29/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Isoform A of Ketohexokinase (Peripheral) |
|---|
| Name: | Isoform A of Ketohexokinase (Peripheral) |
|---|
| Synonyms: | KHK | KHK_HUMAN | Ketohexokinase (KHK) Isoform A | Ketohexokinase (Peripheral) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 32727.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 298 |
|---|
| Sequence: | MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
|
|
|
|---|
| BDBM319585 |
|---|
| n/a |
|---|
| Name | BDBM319585 |
|---|
| Synonyms: | US10174007, Example 4 | US10787438, Example 4 | US10988463, Example 4 | US11634410, Example 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19F3N4O2 |
|---|
| Mol. Mass. | 356.3429 |
|---|
| SMILES | C[C@H]1CCN1c1nc(cc(n1)C(F)(F)F)N1C[C@H]2[C@H](CC(O)=O)[C@H]2C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
