Reaction Details |
| Report a problem with these data |
Target | Isoform A of Ketohexokinase (Peripheral) |
---|
Ligand | BDBM319600 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biological Assay |
---|
IC50 | 12.1±n/a nM |
---|
Citation | Dowling, M; Fernando, D; Futatsugi, K; Huard, K; Magee, TV; Raymer, B; Shavnya, A; Smith, A; Thuma, B; Tsai, A; Tu, M Substituted 3-azabicyclo[3.1.0]hexanes as ketohexokinase inhibitors US Patent US10787438 Publication Date 9/29/2020 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isoform A of Ketohexokinase (Peripheral) |
---|
Name: | Isoform A of Ketohexokinase (Peripheral) |
Synonyms: | KHK | KHK_HUMAN | Ketohexokinase (KHK) Isoform A | Ketohexokinase (Peripheral) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 32727.42 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 298 |
Sequence: | MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
|
|
|
BDBM319600 |
---|
n/a |
---|
Name | BDBM319600 |
Synonyms: | US10174007, Example 24 | US10787438, Example 24 | US11634410, Example 24 | [(1R,5S,6R)-3-{2-[(2S,3R)-3-hydroxy-2-methylazetidin-1-yl]-5-methyl-6-(trifluoromethyl)pyrimidin-4-yl}-3-azabicyclo[3.1.0]hex-6-yl]acetic acid |
Type | Small organic molecule |
Emp. Form. | C17H21F3N4O3 |
Mol. Mass. | 386.3688 |
SMILES | C[C@H]1[C@H](O)CN1c1nc(N2C[C@H]3[C@H](CC(O)=O)[C@H]3C2)c(C)c(n1)C(F)(F)F |
Structure |
|