Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Interleukin-6 |
---|
Ligand | BDBM483321 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | IL-6 Induction assay |
---|
EC50 | 360±n/a nM |
---|
Citation | Poudel, YB; He, L; Gangwar, S; Posy, SL; Sivaprakasam, P Toll-like receptor 7 (TLR7) agonists having a pyridine or pyrazine moiety, conjugates thereof, and methods and uses therefor US Patent US10919895 Publication Date 2/16/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interleukin-6 |
---|
Name: | Interleukin-6 |
Synonyms: | B-cell stimulatory factor 2 | BSF-2 | CDF | CTL differentiation factor | Hybridoma growth factor | IFN-beta-2 | IFNB2 | IL-6 | IL6 | IL6_HUMAN | Interferon beta-2 |
Type: | n/a |
Mol. Mass.: | 23717.96 |
Organism: | Homo sapiens (Human) |
Description: | P05231 |
Residue: | 212 |
Sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
|
|
BDBM483321 |
---|
n/a |
---|
Name | BDBM483321 |
Synonyms: | US10919895, Compound Ia-05 |
Type | Small organic molecule |
Emp. Form. | C18H24N8O2 |
Mol. Mass. | 384.4356 |
SMILES | CCCCOc1nc(N)c2nc(O)n(Cc3cnc(CNC4CC4)cn3)c2n1 |
Structure |
|