| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 2 [348-455] |
|---|
| Ligand | BDBM50452553 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Isothermal Titration Calorimetry Analysis of Binding to Brd2-BD1 and Brd2-BD2 |
|---|
| Kd | 36±n/a nM |
|---|
| Citation |  Guy, RK; Slavish, PJ; Shadrick, WR; Young, BM; Boyd, VA; Bharatham, N; Price, JE; Shelat, A Tetrahydroquinoline-based bromodomain inhibitors US Patent US11028051 Publication Date 6/8/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 2 [348-455] |
|---|
| Name: | Bromodomain-containing protein 2 [348-455] |
|---|
| Synonyms: | BET bromodomain 2(2) (BRD2(2)) | BRD2 | BRD2-BD2 | BRD2_HUMAN | Bromodomain-containing protein 2 (aa 348-455) | KIAA9001 | RING3 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 12751.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25440[348-455] |
|---|
| Residue: | 108 |
|---|
| Sequence: | EQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRD
YRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
|
|
|
|---|
| BDBM50452553 |
|---|
| n/a |
|---|
| Name | BDBM50452553 |
|---|
| Synonyms: | CHEMBL4202664 | US11028051, Cmpd 54 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25N3O3 |
|---|
| Mol. Mass. | 355.4308 |
|---|
| SMILES | CC(C)OC(=O)N[C@@H]1C[C@H](C)N(C(C)=O)c2ccc(cc12)-c1ccc[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
