| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Activin receptor type-1 [172-499,R206H] |
|---|
| Ligand | BDBM522104 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Enzyme Inhibition Using a Biochemical Peptide Phosphorylation Assay- Caliper Assay |
|---|
| IC50 | 810±n/a nM |
|---|
| Citation |  Arista, L; Chamoin, S; D''Alessandro, PL; Lindvall, M; Lizos, D; Stiefl, NJ; Teixeira-Fouchard, S; Ullrich, T; Weiler, S Pyridinone derivatives and their use as selective ALK-2 inhibitors US Patent US11160797 Publication Date 11/2/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Activin receptor type-1 [172-499,R206H] |
|---|
| Name: | Activin receptor type-1 [172-499,R206H] |
|---|
| Synonyms: | ACVR1 | ACVR1_HUMAN | ACVRLK2 | Activin receptor type-1 (ALK2 FOP) (R206H aa 172-499) | Activin receptor type-1 (ALK2)(FOP)(R206H) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37120.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 172-499 |
|---|
| Residue: | 328 |
|---|
| Sequence: | TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVAHQITLLECVGKGRYGEVWRGSWQGEN
VAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSL
YDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCC
IADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVL
WEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLA
KLMKECWYQNPSARLTALRIKKTLTKID
|
|
|
|---|
| BDBM522104 |
|---|
| n/a |
|---|
| Name | BDBM522104 |
|---|
| Synonyms: | US11160797, Example 12 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H16F3N3O2 |
|---|
| Mol. Mass. | 399.3658 |
|---|
| SMILES | CN1C(=O)Cc2cc(ccc12)-c1cncc(c1)-c1ccc(=O)n(CC(F)(F)F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
