Reaction Details |
| Report a problem with these data |
Target | Activin receptor type-1 [172-499,R206H] |
---|
Ligand | BDBM522135 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Enzyme Inhibition Using a Biochemical Peptide Phosphorylation Assay- Caliper Assay |
---|
IC50 | 90.0±n/a nM |
---|
Citation | Arista, L; Chamoin, S; D''Alessandro, PL; Lindvall, M; Lizos, D; Stiefl, NJ; Teixeira-Fouchard, S; Ullrich, T; Weiler, S Pyridinone derivatives and their use as selective ALK-2 inhibitors US Patent US11160797 Publication Date 11/2/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Activin receptor type-1 [172-499,R206H] |
---|
Name: | Activin receptor type-1 [172-499,R206H] |
Synonyms: | ACVR1 | ACVR1_HUMAN | ACVRLK2 | Activin receptor type-1 (ALK2 FOP) (R206H aa 172-499) | Activin receptor type-1 (ALK2)(FOP)(R206H) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 37120.09 |
Organism: | Homo sapiens (Human) |
Description: | aa 172-499 |
Residue: | 328 |
Sequence: | TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVAHQITLLECVGKGRYGEVWRGSWQGEN
VAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSL
YDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCC
IADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVL
WEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLA
KLMKECWYQNPSARLTALRIKKTLTKID
|
|
|
BDBM522135 |
---|
n/a |
---|
Name | BDBM522135 |
Synonyms: | US11160797, Example 43 |
Type | Small organic molecule |
Emp. Form. | C21H21N5O2 |
Mol. Mass. | 375.4237 |
SMILES | CC(C)n1cc(ccc1=O)-c1nc(cnc1N)-c1ccc2N(C)C(=O)Cc2c1 |
Structure |
|