Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Potassium channel subfamily K member 3 |
---|
Ligand | BDBM532166 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition of Recombinant TASK-1 and TASK-3 In Vitro |
---|
IC50 | 1700±n/a nM |
---|
Citation | Delbeck, M; Hahn, M; Müller, T; Lustig, K; Anlahr, J; Collins, K; Nicolai, J; Beck-Broichsitter, M; Albus, U; Gehring, D; Rosenstein, B; Dang, H; Duan, D; Yang, J; Chen, D Substituted bridged diazepane derivatives and use thereof as TASK-1 and TASK-3 inhibitors US Patent US11208422 Publication Date 12/28/2021 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Potassium channel subfamily K member 3 |
---|
Name: | Potassium channel subfamily K member 3 |
Synonyms: | Acid-sensitive potassium channel TASK-1 | Acid-sensitive potassium channel protein TASK-1 | KCNK3 | KCNK3_HUMAN | Potassium channel protein TASK-1 | Potassium channel subfamily K member 3 | Potassium channel subfamily K member 3 (TASK-1) | TASK | TASK1 | TWIK-related acid-sensitive K(+) channel 1 | Two pore K(+) channel KT3.1 | Two pore potassium channel KT3.1 |
Type: | Protein |
Mol. Mass.: | 43534.71 |
Organism: | Homo sapiens (Human) |
Description: | O14649 |
Residue: | 394 |
Sequence: | MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
|
|
|
BDBM532166 |
---|
n/a |
---|
Name | BDBM532166 |
Synonyms: | US11208422, Example 15 | US11208422, Example 16 | [3-{[2-(5-Chloropyridin-2-yl)imidazo[1,2-a]pyridin-3-yl]methyl}-3,9-diazabicyclo[4.2.1]non-9-yl](3-fluoro-6-methoxypyridin-2-yl)methanone (Enantiomer 1) |
Type | Small organic molecule |
Emp. Form. | C27H26ClFN6O2 |
Mol. Mass. | 520.986 |
SMILES | COc1ccc(F)c(n1)C(=O)N1C2CCC1CN(Cc1c(nc3ccccn13)-c1ccc(Cl)cn1)CC2 |
Structure |
|