| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Androgen receptor [633-919] |
|---|
| Ligand | BDBM468362 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Affinity Assay |
|---|
| Ki | 606±n/a nM |
|---|
| Citation |  Narayanan, R; Miller, DD; Ponnusamy, T; Hwang, D; He, Y Selective androgen receptor degrader (SARD) ligands and methods of use thereof US Patent US11230523 Publication Date 1/25/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Androgen receptor [633-919] |
|---|
| Name: | Androgen receptor [633-919] |
|---|
| Synonyms: | ANDR_HUMAN | AR | Androgen receptor (633-919) | DHTR | NR3C4 |
|---|
| Type: | aa 633-919 |
|---|
| Mol. Mass.: | 33165.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10275[633-919] |
|---|
| Residue: | 287 |
|---|
| Sequence: | KKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDN
NQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGW
RSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALL
LFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIAR
ELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT
|
|
|
|---|
| BDBM468362 |
|---|
| n/a |
|---|
| Name | BDBM468362 |
|---|
| Synonyms: | US10806720, Compound 1058 | US11230523, Compound 1058 | US11648234, Compound 1058 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H11BrF4N4O2 |
|---|
| Mol. Mass. | 435.171 |
|---|
| SMILES | C[C@](O)(Cn1cc(Br)c(F)n1)C(=O)Nc1ccc(C#N)c(c1)C(F)(F)F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
