Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
---|
Ligand | BDBM8720 |
---|
Substrate/Competitor | Crotonoyl-ACP |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 6.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 2400±1200 nM |
---|
Citation | Seefeld, MA; Miller, WH; Newlander, KA; Burgess, WJ; DeWolf, WE; Elkins, PA; Head, MS; Jakas, DR; Janson, CA; Keller, PM; Manley, PJ; Moore, TD; Payne, DJ; Pearson, S; Polizzi, BJ; Qiu, X; Rittenhouse, SF; Uzinskas, IN; Wallis, NG; Huffman, WF Indole naphthyridinones as inhibitors of bacterial enoyl-ACP reductases FabI and FabK. J Med Chem46:1627-35 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
Synonyms: | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI | FABI_STAAR | NADPH-dependent enoyl-ACP reductase | fabI | trans-2-enoyl-[acyl carrier protein] reductase |
Type: | Enzyme |
Mol. Mass.: | 27989.00 |
Organism: | Staphylococcus aureus |
Description: | Q6GI75 |
Residue: | 256 |
Sequence: | MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
|
|
|
BDBM8720 |
---|
Crotonoyl-ACP |
---|
Name: | Crotonoyl-ACP |
Synonyms: | n/a |
Type: | Other Protein Type |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | 1. NAD(P)H is its co-substrate. 2. Crotonoyl-ACP was synthesized using ACP synthase to catalyse the addition of a crotonoyl group from crotonoyl-CoA to apo-ACP |
Residue: | 3 |
Sequence: | |