Reaction Details |
| Report a problem with these data |
Target | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Ligand | BDBM8779 |
---|
Substrate/Competitor | BDBM8737 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 35800±n/a nM |
---|
Comments | extracted |
---|
Citation | Seefeld, MA; Miller, WH; Newlander, KA; Burgess, WJ; Payne, DJ; Rittenhouse, SF; Moore, TD; DeWolf, WE; Keller, PM; Qiu, X; Janson, CA; Vaidya, K; Fosberry, AP; Smyth, MG; Jaworski, DD; Slater-Radosti, C; Huffman, WF Inhibitors of bacterial enoyl acyl carrier protein reductase (FabI): 2,9-disubstituted 1,2,3,4-tetrahydropyrido[3,4-b]indoles as potential antibacterial agents. Bioorg Med Chem Lett11:2241-4 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
---|
Name: | Enoyl-[acyl-carrier-protein] reductase [NADH] FabI |
Synonyms: | Enoyl - (acyl carrier protein) reductase | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase | Enoyl-acyl carrier protein reductase (FabI) | FABI_ECOLI | NADH-dependent enoyl-ACP reductase | envM | fabI |
Type: | Enzyme |
Mol. Mass.: | 27861.12 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 262 |
Sequence: | MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
|
|
|
BDBM8779 |
---|
BDBM8737 |
---|
Name | BDBM8779 |
Synonyms: | 1,2,3,4-tetrahydro pyrido[3,4-b]indole 23 | 4-({2-[(2,4-dichlorophenyl)carbonyl]-1H,2H,3H,4H,9H-pyrido[3,4-b]indol-9-yl}methyl)phenol |
Type | Small organic molecule |
Emp. Form. | C25H20Cl2N2O2 |
Mol. Mass. | 451.345 |
SMILES | Oc1ccc(Cn2c3CN(CCc3c3ccccc23)C(=O)c2ccc(Cl)cc2Cl)cc1 |
Structure |
|