| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM639321 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzymatic Activity Assay |
|---|
| IC50 | 41000±n/a nM |
|---|
| Citation |  Beck, H; Mesch, S; Vakalopoulos, A; Pfaff, N; Zimmermann, S; Follmann, M; Kersten, E; Levilain, G; Partikel, K; Broehl, AP; Heitmeier, S; Dietze-Torres, J; Lehmann, L; Gericke, KM; Süßmeier, F; Bärfacker, L; Hillisch, A; Tersteegen, A; Buchmüller, A; Gerdes, C SUBSTITUTED S-ALANINATE DERIVATIVES US Patent US20230391761 Publication Date 12/7/2023 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM639321 |
|---|
| n/a |
|---|
| Name | BDBM639321 |
|---|
| Synonyms: | Methyl 3-{[(5-chloro-2-thienyl)carbonyl]amino}-N-{[2-methyl-3-(2-oxopyrrolidin-1-yl)phenyl]-sulfonyl}-S-alaninate | US20230391761, Reference 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22ClN3O6S2 |
|---|
| Mol. Mass. | 499.988 |
|---|
| SMILES | COC(=O)[C@H](CNC(=O)c1ccc(Cl)s1)NS(=O)(=O)c1cccc(N2CCCC2=O)c1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
