| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 9 [134-239] |
|---|
| Ligand | BDBM321402 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | IC50 measurements for inhibitors using BRD9 AlphaLisa Binding Assay |
|---|
| IC50 | 17.0±n/a nM |
|---|
| Citation |  Albrecht, BK; Bellon, SF; Burdick, DJ; Cote, A; Crawford, T; Dakin, LA; Hsiao-Wei Tsui, V; Hewitt, MC; LeBlanc, Y; Magnuson, SR; Nasveschuk, CG; Romero, FA; Tang, Y; Taylor, AM; Wang, S Therapeutic compounds and uses thereof US Patent US10183009 Publication Date 1/22/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 9 [134-239] |
|---|
| Name: | Bromodomain-containing protein 9 [134-239] |
|---|
| Synonyms: | BRD9 | BRD9 (aa 134-239) | BRD9_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12286.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9H8M2[134-239] |
|---|
| Residue: | 106 |
|---|
| Sequence: | AENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVAN
EYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
|
|
|
|---|
| BDBM321402 |
|---|
| n/a |
|---|
| Name | BDBM321402 |
|---|
| Synonyms: | 6-[(E)-but-2-enyl]-4-[4-(1-hydroxy-1-methyl-ethyl)phenyl]-1H-pyrrolo[2,3-c]pyridin-7-one | US10183009, Example 81 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22N2O2 |
|---|
| Mol. Mass. | 322.4009 |
|---|
| SMILES | C\C=C\Cn1cc(-c2ccc(cc2)C(C)(C)O)c2cc[nH]c2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
