| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phenylethanolamine N-methyltransferase |
|---|
| Ligand | BDBM13041 |
|---|
| Substrate/Competitor | BDBM13015 |
|---|
| Meas. Tech. | Radiochemical Assay of PNMT Inhibitors |
|---|
| pH | 8±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 1100±100 nM |
|---|
| Citation |  Grunewald, GL; Seim, MR; Regier, RC; Martin, JL; Gee, CL; Drinkwater, N; Criscione, KR Comparison of the binding of 3-fluoromethyl-7-sulfonyl-1,2,3,4-tetrahydroisoquinolines with their isosteric sulfonamides to the active site of phenylethanolamine N-methyltransferase. J Med Chem49:5424-33 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Phenylethanolamine N-methyltransferase |
|---|
| Name: | Phenylethanolamine N-methyltransferase |
|---|
| Synonyms: | Noradrenaline N-methyltransferase | PENT | PNMT | PNMT_HUMAN | PNMTase | Phenylethanolamine N-Methyltransferase (PNMT) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 30852.66 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 282 |
|---|
| Sequence: | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
|
|
|
|---|
| BDBM13041 |
|---|
| BDBM13015 |
|---|
| Name | BDBM13041 |
|---|
| Synonyms: | 3-(fluoromethyl)-7-methanesulfonyl-1,2,3,4-tetrahydroisoquinoline | 7-sulfonyl-THIQ 31 | CHEMBL333578 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H14FNO2S |
|---|
| Mol. Mass. | 243.298 |
|---|
| SMILES | CS(=O)(=O)c1ccc2CC(CF)NCc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
