| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Ligand | BDBM13952 |
|---|
| Substrate/Competitor | BDBM13466 |
|---|
| Meas. Tech. | PTP1B and TCPTP Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 24000±n/a nM |
|---|
| Kd | 26000±n/a nM |
|---|
| Comments | Kd derived from 15N-labeled PTP1B |
|---|
| Citation |  Liu, G; Szczepankiewicz, BG; Pei, Z; Janowick, DA; Xin, Z; Hajduk, PJ; Abad-Zapatero, C; Liang, H; Hutchins, CW; Fesik, SW; Ballaron, SJ; Stashko, MA; Lubben, T; Mika, AK; Zinker, BA; Trevillyan, JM; Jirousek, MR Discovery and structure-activity relationship of oxalylarylaminobenzoic acids as inhibitors of protein tyrosine phosphatase 1B. J Med Chem46:2093-103 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Synonyms: | PTN1_HUMAN | PTP-1B | PTP1B | PTPN1 | PTPase 1B | Protein-Tyrosine Phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase, non-receptor type 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34670.65 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The catalytic domain of PTP 1B (residues 1-298) was expressed and purified from E. coli. |
|---|
| Residue: | 298 |
|---|
| Sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
|
|
|
|---|
| BDBM13952 |
|---|
| BDBM13466 |
|---|
| Name | BDBM13952 |
|---|
| Synonyms: | 2-(Naphthalen-1-yloxalylamino)benzoic Acid | 2-(naphthalen-1-ylamidoformic acid)benzoic acid | CHEMBL64934 | naphthyloxamic acid 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H13NO5 |
|---|
| Mol. Mass. | 335.3102 |
|---|
| SMILES | OC(=O)C(=O)N(c1ccccc1C(O)=O)c1cccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
