Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bromodomain-containing protein 4 [349-460] |
---|
Ligand | BDBM259880 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | in vitro kinase inhibition assay |
---|
IC50 | 2310±n/a nM |
---|
Citation | Durden, DL; Morales, GA; Garlich, JR Thienopyranones as kinase and epigenetic inhibitors US Patent US10308662 Publication Date 6/4/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bromodomain-containing protein 4 [349-460] |
---|
Name: | Bromodomain-containing protein 4 [349-460] |
Synonyms: | BRD4 | BRD4 bromodomain 2 | BRD4_HUMAN | Brd4-2 | HUNK1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 13087.06 |
Organism: | Homo sapiens (Human) |
Description: | O60885[349-460] |
Residue: | 112 |
Sequence: | KVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLE
AREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE
|
|
|
BDBM259880 |
---|
n/a |
---|
Name | BDBM259880 |
Synonyms: | US10308662, Compound 121 | US9505780, 121 |
Type | Small organic molecule |
Emp. Form. | C30H21F3IN3O4S |
Mol. Mass. | 703.47 |
SMILES | Fc1ccc(C(=O)Nc2ccc(cc2)-c2csc3c2oc(cc3=O)N2CCOCC2)c(Nc2ccc(I)cc2F)c1F |
Structure |
|