| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 4 [349-460] |
|---|
| Ligand | BDBM50427454 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | in vitro kinase inhibition assay |
|---|
| IC50 | 3451±n/a nM |
|---|
| Citation |  Durden, DL; Morales, GA; Garlich, JR Thienopyranones as kinase and epigenetic inhibitors US Patent US10308662 Publication Date 6/4/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 4 [349-460] |
|---|
| Name: | Bromodomain-containing protein 4 [349-460] |
|---|
| Synonyms: | BRD4 | BRD4 bromodomain 2 | BRD4_HUMAN | Brd4-2 | HUNK1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13087.06 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O60885[349-460] |
|---|
| Residue: | 112 |
|---|
| Sequence: | KVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLE
AREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDE
|
|
|
|---|
| BDBM50427454 |
|---|
| n/a |
|---|
| Name | BDBM50427454 |
|---|
| Synonyms: | CHEMBL2322239 | US10308662, Compound 6 | US9505780, 6 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15NO3S |
|---|
| Mol. Mass. | 313.371 |
|---|
| SMILES | O=c1cc(oc2c(csc12)-c1ccccc1)N1CCOCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
