| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ubiquitin carboxyl-terminal hydrolase isozyme L1 |
|---|
| Ligand | BDBM53463 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Activity Assay |
|---|
| pH | 7.6±0 |
|---|
| Temperature | 298.15±0 K |
|---|
| IC50 | 5.2e+4±n/a nM |
|---|
| Citation |  Liu, Y; Lashuel, HA; Choi, S; Xing, X; Case, A; Ni, J; Yeh, LA; Cuny, GD; Stein, RL; Lansbury, PT Discovery of inhibitors that elucidate the role of UCH-L1 activity in the H1299 lung cancer cell line. Chem Biol10:837-46 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Ubiquitin carboxyl-terminal hydrolase isozyme L1 |
|---|
| Name: | Ubiquitin carboxyl-terminal hydrolase isozyme L1 |
|---|
| Synonyms: | UCH-L1 | UCHL1_MOUSE | Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCH-L1) | Ubiquitin thioesterase L1 | Uchl1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24830.93 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | Q9R0P9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKLSPEDRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
|
|
|
|---|
| BDBM53463 |
|---|
| n/a |
|---|
| Name | BDBM53463 |
|---|
| Synonyms: | 1-[[4-(1-adamantyl)phenyl]methylideneamino]thiourea | 4-(1-adamantyl)benzaldehyde thiosemicarbazone | MLS001000567 | O-acyl oxime isatin derivative, 45 | SMR000496110 | [[4-(1-adamantyl)benzylidene]amino]thiourea | [[4-(1-adamantyl)phenyl]methylideneamino]thiourea | cid_2839927 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H23N3S |
|---|
| Mol. Mass. | 313.46 |
|---|
| SMILES | [H]C12CC3([H])CC([H])(C1)CC(C2)(C3)c1ccc(C=NNC(N)=S)cc1 |w:18.21,TLB:8:1:12:6.9.5,8:6:12:1.11.2,THB:5:6:11:3.12.2| |
|---|
| Structure | 
|
|---|
Search and Browse
