| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitochondrial import inner membrane translocase subunit TIM23 |
|---|
| Ligand | BDBM50088 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of uHTS small molecule inhibitors of tim10-1: a luminescent tim23-1 yeast counterscreen. |
|---|
| IC50 | 5660±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of uHTS small molecule inhibitors of tim10-1: a luminescent tim23-1 yeast counterscreen. PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mitochondrial import inner membrane translocase subunit TIM23 |
|---|
| Name: | Mitochondrial import inner membrane translocase subunit TIM23 |
|---|
| Synonyms: | MAS6 | MIM23 | MPI3 | TIM23 | TIM23_YEAST | TPA: Essential component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23245.32 |
|---|
| Organism: | Saccharomyces cerevisiae S288c |
|---|
| Description: | gi_285814664 |
|---|
| Residue: | 222 |
|---|
| Sequence: | MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP
LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG
LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG
AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK
|
|
|
|---|
| BDBM50088 |
|---|
| n/a |
|---|
| Name | BDBM50088 |
|---|
| Synonyms: | 2-(4-tert-butylbenzyl)-1,2,3,4-benzothiatriazine 1,1-dioxide | 2-[(4-tert-butylphenyl)methyl]-1,2,3,4-benzothiatriazine 1,1-dioxide | 2-[4-(tert-butyl)benzyl]-1lambda~6~,2,3,4-benzothiatriazine-1,1(2H)-dione | MLS000544980 | SMR000126737 | cid_3775134 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H19N3O2S |
|---|
| Mol. Mass. | 329.417 |
|---|
| SMILES | CC(C)(C)c1ccc(CN2N=Nc3ccccc3S2(=O)=O)cc1 |c:10| |
|---|
| Structure | 
|
|---|
Search and Browse
