| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitochondrial import inner membrane translocase subunit TIM23 |
|---|
| Ligand | BDBM78361 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of uHTS small molecule inhibitors of tim10-1: a luminescent tim23-1 yeast counterscreen. |
|---|
| IC50 | 2460±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of uHTS small molecule inhibitors of tim10-1: a luminescent tim23-1 yeast counterscreen. PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mitochondrial import inner membrane translocase subunit TIM23 |
|---|
| Name: | Mitochondrial import inner membrane translocase subunit TIM23 |
|---|
| Synonyms: | MAS6 | MIM23 | MPI3 | TIM23 | TIM23_YEAST | TPA: Essential component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 23245.32 |
|---|
| Organism: | Saccharomyces cerevisiae S288c |
|---|
| Description: | gi_285814664 |
|---|
| Residue: | 222 |
|---|
| Sequence: | MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP
LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG
LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG
AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK
|
|
|
|---|
| BDBM78361 |
|---|
| n/a |
|---|
| Name | BDBM78361 |
|---|
| Synonyms: | 1-(3-Chloro-phenyl)-3-diethylamino-pyrrolidine-2,5-dione | 1-(3-chlorophenyl)-3-(diethylamino)pyrrolidine-2,5-dione | 1-(3-chlorophenyl)-3-(diethylamino)pyrrolidine-2,5-quinone | MLS001203275 | SMR000513830 | cid_2840997 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H17ClN2O2 |
|---|
| Mol. Mass. | 280.75 |
|---|
| SMILES | CCN(CC)c1cc(O)n(c1O)-c1cccc(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
