| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM50242224 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1670822 (CHEMBL4020851) |
|---|
| IC50 | 510±n/a nM |
|---|
| Citation |  Zhu, M; Harshbarger, WD; Robles, O; Krysiak, J; Hull, KG; Cho, SW; Richardson, RD; Yang, Y; Garcia, A; Spiegelman, L; Ramirez, B; Wilson, CT; Yau, JA; Moore, JT; Walker, CB; Sacchettini, JC; Liu, WR; Sieber, SA; Smith, JW; Romo, D A strategy for dual inhibition of the proteasome and fatty acid synthase with belactosin C-orlistat hybrids. Bioorg Med Chem25:2901-2916 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM50242224 |
|---|
| n/a |
|---|
| Name | BDBM50242224 |
|---|
| Synonyms: | CHEMBL4070939 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H37N3O7 |
|---|
| Mol. Mass. | 515.5986 |
|---|
| SMILES | CCCCCC[C@H]1[C@@H](OC1=O)C(=O)NCCCC[C@@H]1NC(=O)N([C@@H](C)C(=O)OCc2ccccc2)C1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
