| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50273902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1713600 (CHEMBL4123649) |
|---|
| EC50 | 3.0±n/a nM |
|---|
| Citation |  Naidu, BN; Walker, MA; Sorenson, ME; Ueda, Y; Matiskella, JD; Connolly, TP; Dicker, IB; Lin, Z; Bollini, S; Terry, BJ; Higley, H; Zheng, M; Parker, DD; Wu, D; Adams, S; Krystal, MR; Meanwell, NA The discovery and preclinical evaluation of BMS-707035, a potent HIV-1 integrase strand transfer inhibitor. Bioorg Med Chem Lett28:2124-2130 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50273902 |
|---|
| n/a |
|---|
| Name | BDBM50273902 |
|---|
| Synonyms: | CHEMBL4126659 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H27FN4O5S |
|---|
| Mol. Mass. | 478.537 |
|---|
| SMILES | CN(C)S(=O)(=O)c1cc(F)ccc1CNC(=O)c1nc2n(CCCC22CCCC2)c(=O)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
