| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 4 |
|---|
| Ligand | BDBM50278673 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1719140 (CHEMBL4134140) |
|---|
| EC50 | 42±n/a nM |
|---|
| Citation |  Zhang, X; Cai, C; Sui, Z; Macielag, M; Wang, Y; Yan, W; Suckow, A; Hua, H; Bell, A; Haug, P; Clapper, W; Jenkinson, C; Gunnet, J; Leonard, J; Murray, WV Discovery of an Isothiazole-Based Phenylpropanoic Acid GPR120 Agonist as a Development Candidate for Type 2 Diabetes. ACS Med Chem Lett8:947-952 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 4 |
|---|
| Name: | Free fatty acid receptor 4 |
|---|
| Synonyms: | FFAR4 | FFAR4_HUMAN | G-protein coupled receptor 120 | G-protein coupled receptor 129 | G-protein coupled receptor GT01 | G-protein coupled receptor PGR4 | GPR120 | GPR129 | O3FAR1 | Omega-3 fatty acid receptor 1 | PGR4 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 42256.91 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1508994 |
|---|
| Residue: | 377 |
|---|
| Sequence: | MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVC
ALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTL
SGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVV
PQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDA
RAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITI
LLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGA
ILTDTSVKRNDLSIISG
|
|
|
|---|
| BDBM50278673 |
|---|
| n/a |
|---|
| Name | BDBM50278673 |
|---|
| Synonyms: | CHEMBL4165366 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H12ClF6NO3S |
|---|
| Mol. Mass. | 495.823 |
|---|
| SMILES | OC(=O)CCc1cc(F)c(OCc2c(nsc2C(F)(F)F)-c2ccc(Cl)cc2F)c(F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
