Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50083351 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1757530 (CHEMBL4192538) |
---|
Ki | 98±n/a nM |
---|
Citation | Dey, S; Temme, L; Schreiber, JA; Schepmann, D; Frehland, B; Lehmkuhl, K; Strutz-Seebohm, N; Seebohm, G; Wünsch, B Deconstruction - reconstruction approach to analyze the essential structural elements of tetrahydro-3-benzazepine-based antagonists of GluN2B subunit containing NMDA receptors. Eur J Med Chem138:552-564 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50083351 |
---|
n/a |
---|
Name | BDBM50083351 |
Synonyms: | (+/-)-[2-(4-benzylpiperidino)-1-(4-hydroxyphenyl)-1-propanol] | -(2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl)phenol | 4-(2-(4-benzylpiperidin-1-yl)-1-hydroxypropyl)phenol | 4-[2-(4-Benzyl-piperidin-1-yl)-1-hydroxy-propyl]-phenol | CHEMBL305187 | ChEMBL_104385 | IFENPRODIL |
Type | Small organic molecule |
Emp. Form. | C21H27NO2 |
Mol. Mass. | 325.4446 |
SMILES | CC(C(O)c1ccc(O)cc1)N1CCC(Cc2ccccc2)CC1 |
Structure |
|