| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glycylpeptide N-tetradecanoyltransferase |
|---|
| Ligand | BDBM50109882 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1759474 (CHEMBL4194482) |
|---|
| IC50 | 5.7±n/a nM |
|---|
| Citation |  Liu, N; Tu, J; Dong, G; Wang, Y; Sheng, C Emerging New Targets for the Treatment of Resistant Fungal Infections. J Med Chem61:5484-5511 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Glycylpeptide N-tetradecanoyltransferase |
|---|
| Name: | Glycylpeptide N-tetradecanoyltransferase |
|---|
| Synonyms: | 2.3.1.97 | Glycylpeptide N-tetradecanoyltransferase | Myristoyl-CoA:protein N-myristoyltransferase | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D110A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D112A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt D412A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F115A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F117A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F240A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F339A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt F339S)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt G413A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt H227A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt I111A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt I352A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L350V)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L451A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt L451Q)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt N175A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt P229A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt S241A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt T114A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt T211A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt V108A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt W232A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y107A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y119A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y225A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y256A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt Y354A)) | Myristoyl-CoA:protein N-myristoyltransferase (Nmt) | NMT | NMT1 | NMT_CANAL | Peptide N-myristoyltransferase | Peptide N-myristoyltransferase 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 51875.96 |
|---|
| Organism: | Candida albicans (Yeast) |
|---|
| Description: | P30418 |
|---|
| Residue: | 451 |
|---|
| Sequence: | MSGDNTGNKSNSAPSKSIEELLKLLAMGQELSPAQQKEMKDYKFWKTQPVPSLSETVTEE
GPIDKLKTPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYS
HEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIH
KKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGF
SHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEF
KHWMLGHDENSDSNVVKSYVVEDENGVITDYFSYYLLPFTVLDNAQHDELGIAYLFYYAS
DSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLF
NYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL
|
|
|
|---|
| BDBM50109882 |
|---|
| n/a |
|---|
| Name | BDBM50109882 |
|---|
| Synonyms: | 3-(3-methyl-2-((2,3,4-trifluorophenoxy)methyl)benzofuran-4-yloxy)-N-(pyridin-3-ylmethyl)propan-1-amine | CHEMBL347048 | {3-[3-Methyl-2-(2,3,4-trifluoro-phenoxymethyl)-benzofuran-4-yloxy]-propyl}-pyridin-3-ylmethyl-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23F3N2O3 |
|---|
| Mol. Mass. | 456.4569 |
|---|
| SMILES | Cc1c(COc2ccc(F)c(F)c2F)oc2cccc(OCCCNCc3cccnc3)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
