| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Farnesyl pyrophosphate synthase |
|---|
| Ligand | BDBM12578 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1795608 (CHEMBL4267725) |
|---|
| IC50 | 60±n/a nM |
|---|
| Citation |  Savino, S; Toscano, A; Purgatorio, R; Profilo, E; Laghezza, A; Tortorella, P; Angelelli, M; Cellamare, S; Scala, R; Tricarico, D; Marobbio, CMT; Perna, F; Vitale, P; Agamennone, M; Dimiccoli, V; Tolomeo, A; Scilimati, A Novel bisphosphonates with antiresorptive effect in bone mineralization and osteoclastogenesis. Eur J Med Chem158:184-200 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Farnesyl pyrophosphate synthase |
|---|
| Name: | Farnesyl pyrophosphate synthase |
|---|
| Synonyms: | Dimethylallyltranstransferase | FDPS | FPP synthase | FPP synthetase | FPPS_HUMAN | FPS | Farnesyl diphosphate synthase | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | KIAA1293 | P14324 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 48272.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14324 |
|---|
| Residue: | 419 |
|---|
| Sequence: | MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
|
|
|
|---|
| BDBM12578 |
|---|
| n/a |
|---|
| Name | BDBM12578 |
|---|
| Synonyms: | 2-(imidazol-1-yl)-1-hydroxyethylidene-1,1-bisphosphonic acid | Bisphosphonate 3 | CGP-42446 | CHEMBL924 | JMC515594 Compound 55 | Reclast | US11279719, Example Zolendronic acid (ZOL) | ZOL | Zoledronate | Zometa | [1-hydroxy-2-(1H-imidazol-1-yl)-1-phosphonoethyl]phosphonic acid | zoledronic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C5H10N2O7P2 |
|---|
| Mol. Mass. | 272.0896 |
|---|
| SMILES | OC(Cn1ccnc1)(P(O)(O)=O)P(O)(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
