| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HIV-1 protease |
|---|
| Ligand | BDBM50480933 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_594352 (CHEMBL1048550) |
|---|
| Ki | 16±n/a nM |
|---|
| Citation |  Mahalingam, AK; Axelsson, L; Ekegren, JK; Wannberg, J; Kihlström, J; Unge, T; Wallberg, H; Samuelsson, B; Larhed, M; Hallberg, A HIV-1 protease inhibitors with a transition-state mimic comprising a tertiary alcohol: improved antiviral activity in cells. J Med Chem53:607-15 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HIV-1 protease |
|---|
| Name: | HIV-1 protease |
|---|
| Synonyms: | HIV-1 | HIV-1 protease | protease |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10795.19 |
|---|
| Organism: | Human immunodeficiency virus |
|---|
| Description: | ChEMBL_118439 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50480933 |
|---|
| n/a |
|---|
| Name | BDBM50480933 |
|---|
| Synonyms: | CHEMBL583370 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H47N5O6 |
|---|
| Mol. Mass. | 693.8311 |
|---|
| SMILES | COC(=O)N[C@H](C(=O)NN(CC[C@@](O)(Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)Cc1ccc(cc1)-c1ccccn1)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
