Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50041935 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54909 (CHEMBL884365) |
---|
IC50 | 45000±n/a nM |
---|
Citation | Rosowsky, A; Mota, CE; Wright, JE; Freisheim, JH; Heusner, JJ; McCormack, JJ; Queener, SF 2,4-Diaminothieno[2,3-d]pyrimidine analogues of trimetrexate and piritrexim as potential inhibitors of Pneumocystis carinii and Toxoplasma gondii dihydrofolate reductase. J Med Chem36:3103-12 (1993) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_LACCA | dhfR | folA |
Type: | PROTEIN |
Mol. Mass.: | 18437.08 |
Organism: | Lactobacillus casei |
Description: | ChEMBL_1357878 |
Residue: | 163 |
Sequence: | MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAQGAVVVHDVAAVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
|
|
|
BDBM50041935 |
---|
n/a |
---|
Name | BDBM50041935 |
Synonyms: | 5,6,7,8,9,10-Hexahydro-11-thia-1,3-diaza-cycloocta[a]indene-2,4-diamine | CHEMBL108006 |
Type | Small organic molecule |
Emp. Form. | C12H16N4S |
Mol. Mass. | 248.347 |
SMILES | Nc1nc(N)c2c3CCCCCCc3sc2n1 |
Structure |
|