Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50043962 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201739 (CHEMBL803935) |
---|
IC50 | 7250±n/a nM |
---|
Citation | Reddy, NL; Hu, LY; Cotter, RE; Fischer, JB; Wong, WJ; McBurney, RN; Weber, E; Holmes, DL; Wong, ST; Prasad, R Synthesis and structure-activity studies of N,N'-diarylguanidine derivatives. N-(1-naphthyl)-N'-(3-ethylphenyl)-N'-methylguanidine: a new, selective noncompetitive NMDA receptor antagonist. J Med Chem37:260-7 (1994) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50043962 |
---|
n/a |
---|
Name | BDBM50043962 |
Synonyms: | CHEMBL91828 | N'-(2-Isopropyl-phenyl)-N-methyl-N-naphthalen-1-yl-guanidine |
Type | Small organic molecule |
Emp. Form. | C21H23N3 |
Mol. Mass. | 317.4274 |
SMILES | CC(C)c1ccccc1N=C(N)N(C)c1cccc2ccccc12 |w:9.9| |
Structure |
|