| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50063482 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_54944 (CHEMBL669015) |
|---|
| IC50 | 220±n/a nM |
|---|
| Citation |  Rosowsky, A; Papoulis, AT; Queener, SF 2,4-Diamino-6,7-dihydro-5H-cyclopenta[d]pyrimidine analogues of trimethoprim as inhibitors of Pneumocystis carinii and Toxoplasma gondii dihydrofolate reductase. J Med Chem41:913-8 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50063482 |
|---|
| n/a |
|---|
| Name | BDBM50063482 |
|---|
| Synonyms: | 5-[3-(3,4,5-Trimethoxy-phenyl)-propyl]-6,7-dihydro-5H-cyclopentapyrimidine-2,4-diamine | CHEMBL176332 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H26N4O3 |
|---|
| Mol. Mass. | 358.4347 |
|---|
| SMILES | COc1cc(CCCC2CCc3nc(N)nc(N)c23)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
