| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Ligand | BDBM50311742 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1839104 (CHEMBL4339319) |
|---|
| IC50 | 20000±n/a nM |
|---|
| Citation |  Yokoyama, T; Kitakami, R; Mizuguchi, M Discovery of a new class of MTH1 inhibitor by X-ray crystallographic screening. Eur J Med Chem167:153-160 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Name: | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Synonyms: | 2-hydroxy-dATP diphosphatase | 3.6.1.- | 3.6.1.56 | 7,8-dihydro-8-oxoguanine triphosphatase | 8-oxo-dGTPase | 8ODP_HUMAN | MTH1 | Methylated purine nucleoside triphosphate hydrolase | MutT homolog 1 protein (MTH1) | NUDT1 | Nucleoside diphosphate-linked moiety X motif 1 | Nudix motif 1 | Oxidized purine nucleoside triphosphate hydrolase [42-197] |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22514.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P36639 |
|---|
| Residue: | 156 |
|---|
| Sequence: | MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLT
VDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDD
SYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
|
|
|
|---|
| BDBM50311742 |
|---|
| n/a |
|---|
| Name | BDBM50311742 |
|---|
| Synonyms: | 8-DEOXYGARTANIN | 8-desoxygartanin | CHEMBL488606 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H24O5 |
|---|
| Mol. Mass. | 380.4337 |
|---|
| SMILES | [#6]\[#6](-[#6])=[#6]\[#6]-c1c(-[#8])c(-[#6]\[#6]=[#6](\[#6])-[#6])c2oc3c(-[#8])cccc3c(=O)c2c1-[#8] |
|---|
| Structure | 
|
|---|
Search and Browse
