Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50074732 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_55136 (CHEMBL668779) |
---|
IC50 | 270±n/a nM |
---|
Citation | Rosowsky, A; Papoulis, AT; Forsch, RA; Queener, SF Synthesis and antiparasitic and antitumor activity of 2, 4-diamino-6-(arylmethyl)-5,6,7,8-tetrahydroquinazoline analogues of piritrexim. J Med Chem42:1007-17 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50074732 |
---|
n/a |
---|
Name | BDBM50074732 |
Synonyms: | 6-(Tetrahydro-furan-2-ylmethyl)-5,6,7,8-tetrahydro-quinazoline-2,4-diamine | CHEMBL7170 |
Type | Small organic molecule |
Emp. Form. | C13H20N4O |
Mol. Mass. | 248.3241 |
SMILES | Nc1nc(N)c2CC(CC3CCCO3)CCc2n1 |
Structure |
|