| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50082923 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_52978 (CHEMBL664186) |
|---|
| IC50 | 42±n/a nM |
|---|
| Citation |  Rosowsky, A; Cody, V; Galitsky, N; Fu, H; Papoulis, AT; Queener, SF Structure-based design of selective inhibitors of dihydrofolate reductase: synthesis and antiparasitic activity of 2, 4-diaminopteridine analogues with a bridged diarylamine side chain. J Med Chem42:4853-60 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_PNECA | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23891.29 |
|---|
| Organism: | Pneumocystis carinii |
|---|
| Description: | n/a |
|---|
| Residue: | 206 |
|---|
| Sequence: | MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFESMNVVLMGRK
TWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDHALELLYRTYGSESSVQINRI
FVIGGAQLYKAAMDHPKLDRIMATIIYKDIHCDVFFPLKFRDKEWSSVWKKEKHSDLESW
VGTKVPHGKINEDGFDYEFEMWTRDL
|
|
|
|---|
| BDBM50082923 |
|---|
| n/a |
|---|
| Name | BDBM50082923 |
|---|
| Synonyms: | 6-(9H-Acridin-10-ylmethyl)-pteridine-2,4-diamine | 6-(acridin-10(9H)-ylmethyl)pteridine-2,4-diamine | CHEMBL144839 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H17N7 |
|---|
| Mol. Mass. | 355.3959 |
|---|
| SMILES | Nc1nc(N)c2nc(CN3c4ccccc4Cc4ccccc34)cnc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
